PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G061700.1.p
Common NameSETIT_039129mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 183aa    MW: 19698.6 Da    PI: 10.1624
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G061700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.81.5e-37141141101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk lrrkCa+dC+lapyfpa++p+++ +v+++FGasn+ ++l++lp +er +a+++++ eA++r++dPvyG++g++ +lq +++ ++
  Seita.9G061700.1.p  14 RCAACKNLRRKCAQDCILAPYFPASDPQRYGCVQRVFGASNIARMLQSLPAHERGKAADTIAAEARWRVQDPVYGCAGIVGRLQGEIKAAQ 104
                         6****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                          ela +++++
  Seita.9G061700.1.p 105 CELAWTRAQI 114
                         ****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.66913114IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-3614111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MSKSTEAGRS GSRRCAACKN LRRKCAQDCI LAPYFPASDP QRYGCVQRVF GASNIARMLQ  60
SLPAHERGKA ADTIAAEARW RVQDPVYGCA GIVGRLQGEI KAAQCELAWT RAQIAVHAAA  120
AARPRPAVDA RLSAPAQAAP PPQQQQQGDA LVMQLDPFQG LDALLIDDYR VARGRRSGLM  180
MR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661257.11e-100PREDICTED: LOB domain-containing protein 24-like
SwissprotP594683e-40LBD24_ARATH; LOB domain-containing protein 24
SwissprotP594673e-40LBD23_ARATH; LOB domain-containing protein 23
TrEMBLK4AJQ71e-129K4AJQ7_SETIT; Uncharacterized protein
STRINGSi039129m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.18e-39LOB domain-containing protein 24